EIF1AY Antibody

• Gene Name:

  Eukaryotic translation initiation factor 1A Y-linked

• Gene Aliases:

  EIF-4C; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal; eukaryotic translation initiation factor 4C.

• Gene ID:

  9086

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_004672.2

• Reactivity:

  Human, Mouse

• Immunogen:

  EIF1AY (NP_004672.2, 22 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A) . EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1B4

• Type:

  Monoclonal Antibody

• Sequence:

  EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKY

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  EIF1AY

• Host or Source:

  Mouse

• Protein Name:

  Eukaryotic translation initiation factor 1A, Y-chromosomal isoform 1 [Homo sapiens]|Homo sapiens eukaryotic translation initiation factor 1A, Y-linked, mRNA (cDNA clone MGC:12282 IMAGE:3933718), complete cds

• Gene Name URL:

  EIF1AY

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC005248