EIF1AY Antibody

CAT:
247-OAAL00434-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EIF1AY Antibody - image 1

EIF1AY Antibody

  • Gene Name :

    Eukaryotic translation initiation factor 1A Y-linked
  • Gene Aliases :

    EIF-4C; eukaryotic translation initiation factor 1A, Y chromosome; eukaryotic translation initiation factor 1A, Y-chromosomal; eukaryotic translation initiation factor 4C.
  • Gene ID :

    9086
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_004672.2
  • Reactivity :

    Human, Mouse
  • Immunogen :

    EIF1AY (NP_004672.2, 22 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a protein similar to eukaryotic translation initiation factor 1A (EIF1A) . EIF1A is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    1B4
  • Type :

    Monoclonal Antibody
  • Sequence :

    EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKY
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    EIF1AY
  • Host or Source :

    Mouse
  • Protein Name :

    Eukaryotic translation initiation factor 1A, Y-chromosomal isoform 1 [Homo sapiens]|Homo sapiens eukaryotic translation initiation factor 1A, Y-linked, mRNA (cDNA clone MGC:12282 IMAGE:3933718), complete cds
  • Gene Name URL :

    EIF1AY
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC005248

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide