PRPF4B Antibody

• Gene Name:

  Pre-mRNA processing factor 4B

• Gene Aliases:

  DJ1013A10.1; dJ1013A10.1 (PRP4 protein kinase homolog) ; PR4H; protein-serine/threonine kinase; PRP4; PRP4 kinase; PRP4 pre-mRNA processing factor 4 homolog B; PRP4 pre-mRNA-processing factor 4 homolog; PRP4H; PRP4K; serine/threonine-protein kinase PRP4 homolog.

• Gene ID:

  8899

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_003904.2

• Reactivity:

  Human, Mouse

• Immunogen:

  PRPF4B (NP_003904.2, 898 a.a. ~ 1005 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs) . This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs) . [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  30000000000

• Type:

  Monoclonal Antibody

• Sequence:

  LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  PRPF4B

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens pre-mRNA processing factor 4B (PRPF4B), transcript variant 1, mRNA|serine/threonine-protein kinase PRP4 homolog [Homo sapiens]

• Gene Name URL:

  PRPF4B

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_003913