PER3 Antibody

CAT:
247-OAAL00419-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PER3 Antibody - image 1

PER3 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Period circadian regulator 3
  • Gene Aliases :

    Cell growth-inhibiting gene 13 protein; circadian clock protein PERIOD 3; FASPS3; GIG13; period circadian clock 3; period circadian protein 3; period circadian protein homolog 3.
  • Gene ID :

    8863
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_058515.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PER3 (NP_058515.1, 1105 a.a. ~ 1201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3A7
  • Type :

    Monoclonal Antibody
  • Sequence :

    WRMIRQTPERILMTYQVPERVKEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDSC
  • Applications :

    Enzyme-linked immunosorbent assay|Immunoprecipitation|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    PER3
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens period circadian regulator 3 (PER3), transcript variant 4, mRNA|period circadian protein homolog 3 isoform 4 [Homo sapiens]
  • Gene Name URL :

    PER3
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_016831

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide