MAPKAPK5 Antibody

• Gene Name:

  MAPK activated protein kinase 5

• Gene Aliases:

  MAP kinase-activated protein kinase 5; MAPKAP kinase 5; MAPKAPK-5; MAPKAP-K5; mitogen-activated protein kinase-activated protein kinase 5; MK5; MK-5; p38-regulated/activated protein kinase; PRAK.

• Gene ID:

  8550

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH47284

• Reactivity:

  Human, Mouse

• Immunogen:

  MAPKAPK5 (AAH47284, 371 a.a. ~ 471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is a member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. In vitro, this kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  2D5

• Type:

  Monoclonal Antibody

• Sequence:

  KDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  MAPKAPK5

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens mitogen-activated protein kinase-activated protein kinase 5, mRNA (cDNA clone MGC:54058 IMAGE:4997201), complete cds|Mitogen-activated protein kinase-activated protein kinase 5 [Homo sapiens]

• Gene Name URL:

  MAPKAPK5

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC047284