TTF2 Antibody

CAT:
247-OAAL00398-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TTF2 Antibody - image 1

TTF2 Antibody

  • Gene Name :

    Transcription termination factor 2
  • Gene Aliases :

    F2; HuF2; human factor 2; lodestar homolog; lodestar protein; RNA polymerase II termination factor; transcription release factor 2; transcription termination factor 2; transcription termination factor, RNA polymerase II; ZGRF6; zinc finger, GRF-type containing 6.
  • Gene ID :

    8458
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_003585
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    TTF2 (NP_003585, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    100000000
  • Type :

    Monoclonal Antibody
  • Sequence :

    EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    TTF2
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens transcription termination factor 2 (TTF2), mRNA|transcription termination factor 2 [Homo sapiens]
  • Gene Name URL :

    TTF2
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_003594

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide