BRD3 Antibody

• Gene Name:

  Bromodomain containing 3

• Gene Aliases:

  Bromodomain-containing protein 3; ORFX; RING3L; RING3-like protein.

• Gene ID:

  8019

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH32124

• Reactivity:

  Human, Mouse

• Immunogen:

  BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  6F3

• Type:

  Monoclonal Antibody

• Sequence:

  EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV

• Applications:

  Enzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  BRD3

• Host or Source:

  Mouse

• Protein Name:

  BRD3 protein [Homo sapiens]|Homo sapiens bromodomain containing 3, mRNA (cDNA clone MGC:29612 IMAGE:4856840), complete cds

• Gene Name URL:

  BRD3

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC032124