NR2F2 Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  Nuclear receptor subfamily 2 group F member 2

• Gene Aliases :

  ADP-ribosylation factor related protein 1; apolipoprotein AI regulatory protein 1; apolipoprotein A-I regulatory protein 1; ARP1; ARP-1; chicken ovalbumin upstream promoter transcription factor 2; chicken ovalbumin upstream promoter-transcription factor I; CHTD4; COUP transcription factor 2; COUP transcription factor II; COUPTF2; COUPTFB; COUPTFII; NF-E3; SRXX5; SVP40; TFCOUP2.

• Gene ID :

  7026

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_066285

• Reactivity :

  Human, Mouse

• Immunogen :

  NR2F2 (NP_066285, 153 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Clonality :

  Monoclonal

• Clone :

  3B5

• Type :

  Monoclonal Antibody

• Sequence :

  RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD

• Applications :

  Enzyme-linked immunosorbent assay

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  NR2F2

• Host or Source :

  Mouse

• Protein Name :

  COUP transcription factor 2 isoform a [Homo sapiens]|Homo sapiens nuclear receptor subfamily 2 group F member 2 (NR2F2), transcript variant 1, mRNA

• Gene Name URL :

  NR2F2

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_021005