TCEB3 Antibody

CAT:
247-OAAL00329-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TCEB3 Antibody - image 1

TCEB3 Antibody

  • Gene Name:

    Elongin A
  • Gene Aliases:

    Elongin 110 kDa subunit; elongin-A; RNA polymerase II transcription factor SIII subunit A1; SIII; SIII p110; TCEB3; TCEB3A; transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A) ; transcription elongation factor B alpha subunit; transcription elongation factor B polypeptide 3; transcription elongation factor B subunit 3.
  • Gene ID:

    6924
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/NP_003189
  • Reactivity:

    Human, Mouse
  • Immunogen:

    TCEB3 (NP_003189, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. [provided by RefSeq
  • Clonality:

    Monoclonal
  • Clone:

    1F3
  • Type:

    Monoclonal Antibody
  • Sequence:

    NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY
  • Applications:

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2a Kappa
  • NCBI Gene Symbol:

    ELOA
  • Host or Source:

    Mouse
  • Protein Name:

    Elongin-A [Homo sapiens]|Homo sapiens elongin A (ELOA), mRNA
  • Gene Name URL:

    ELOA
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/NM_003198