MAP3K7 Antibody

• Gene Name :

  Mitogen-activated protein kinase kinase kinase 7

• Gene Aliases :

  CSCF; FMD2; MEKK7; mitogen-activated protein kinase kinase kinase 7; TAK1; TGF1a; TGF-beta activated kinase 1; transforming growth factor-beta-activated kinase 1.

• Gene ID :

  6885

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH17715.1

• Reactivity :

  Human, Mouse

• Immunogen :

  MAP3K7 (AAH17715.1, 471 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  3C9

• Type :

  Monoclonal Antibody

• Sequence :

  MAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  MAP3K7

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens mitogen-activated protein kinase kinase kinase 7, mRNA (cDNA clone MGC:21263 IMAGE:3906837), complete cds|Mitogen-activated protein kinase kinase kinase 7 [Homo sapiens]

• Gene Name URL :

  MAP3K7

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC017715