MAP3K7 Antibody

CAT:
247-OAAL00324-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAP3K7 Antibody - image 1

MAP3K7 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Mitogen-activated protein kinase kinase kinase 7
  • Gene Aliases :

    CSCF; FMD2; MEKK7; mitogen-activated protein kinase kinase kinase 7; TAK1; TGF1a; TGF-beta activated kinase 1; transforming growth factor-beta-activated kinase 1.
  • Gene ID :

    6885
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH17715.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    MAP3K7 (AAH17715.1, 471 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3C9
  • Type :

    Monoclonal Antibody
  • Sequence :

    MAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    MAP3K7
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens mitogen-activated protein kinase kinase kinase 7, mRNA (cDNA clone MGC:21263 IMAGE:3906837), complete cds|Mitogen-activated protein kinase kinase kinase 7 [Homo sapiens]
  • Gene Name URL :

    MAP3K7
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC017715

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide