ST14 Antibody

• Gene Name :

  ST14 transmembrane serine protease matriptase

• Gene Aliases :

  ARCI11; CAP3; channel-activating protein 3; HAI; membrane-type serine protease 1; MTSP1; MT-SP1; prostamin; PRSS14; serine protease 14; serine protease TADG-15; SNC19; suppression of tumorigenicity 14 (colon carcinoma) ; suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin) ; suppressor of tumorigenicity 14 protein; TADG15; TMPRSS14; tumor associated differentially expressed gene 15 protein.

• Gene ID :

  6768

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_068813

• Reactivity :

  Human, Mouse

• Immunogen :

  ST14 (NP_068813, 298 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  2F4

• Type :

  Monoclonal Antibody

• Sequence :

  PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD

• Applications :

  Enzyme-linked immunosorbent assay

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  ST14

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens suppression of tumorigenicity 14 (ST14), mRNA|suppressor of tumorigenicity 14 protein [Homo sapiens]

• Gene Name URL :

  ST14

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_021978