SSR2 Antibody

CAT:
247-OAAL00315-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SSR2 Antibody - image 1

SSR2 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Signal sequence receptor subunit 2
  • Gene Aliases :

    HSD25; signal sequence receptor subunit beta; signal sequence receptor, beta (translocon-associated protein beta) ; SSR-beta; TLAP; translocon-associated protein beta; translocon-associated protein subunit beta; TRAPB; TRAP-BETA.
  • Gene ID :

    6746
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_003136.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    SSR2 (NP_003136.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2) . The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    4C1
  • Type :

    Monoclonal Antibody
  • Sequence :

    SSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDW
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    SSR2
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens signal sequence receptor subunit 2 (SSR2), mRNA|translocon-associated protein subunit beta precursor [Homo sapiens]
  • Gene Name URL :

    SSR2
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_003145

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide