SSR2 Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  Signal sequence receptor subunit 2

• Gene Aliases :

  HSD25; signal sequence receptor subunit beta; signal sequence receptor, beta (translocon-associated protein beta) ; SSR-beta; TLAP; translocon-associated protein beta; translocon-associated protein subunit beta; TRAPB; TRAP-BETA.

• Gene ID :

  6746

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_003136.1

• Reactivity :

  Human, Mouse

• Immunogen :

  SSR2 (NP_003136.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2) . The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  4C1

• Type :

  Monoclonal Antibody

• Sequence :

  SSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDW

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  SSR2

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens signal sequence receptor subunit 2 (SSR2), mRNA|translocon-associated protein subunit beta precursor [Homo sapiens]

• Gene Name URL :

  SSR2

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_003145