SCP2 Antibody

CAT:
247-OAAL00299-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SCP2 Antibody - image 1

SCP2 Antibody

  • Gene Name:

    Sterol carrier protein 2
  • Gene Aliases:

    Acetyl-CoA C-myristoyltransferase; epididymis secretory sperm binding protein; NLTP; non-specific lipid-transfer protein; NSL-TP; propanoyl-CoA C-acyltransferase; SCOX; SCP-2; SCP-2/3-oxoacyl-CoA thiolase; SCP-2/thiolase; SCP-CHI; SCPX; SCP-X; sterol carrier protein 2; sterol carrier protein X; straight-chain acyl-CoA oxidase.
  • Gene ID:

    6342
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/AAH05911
  • Reactivity:

    Human, Mouse
  • Immunogen:

    SCP2 (AAH05911, 1 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined. [provided by RefSeq
  • Clonality:

    Monoclonal
  • Clone:

    2E9-1B3
  • Type:

    Monoclonal Antibody
  • Sequence:

    MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
  • Applications:

    Enzyme-linked immunosorbent assay|Immunoprecipitation|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2a kappa
  • NCBI Gene Symbol:

    SCP2
  • Host or Source:

    Mouse
  • Protein Name:

    Homo sapiens sterol carrier protein 2, mRNA (cDNA clone IMAGE:4287946), complete cds|Sterol carrier protein 2 [Homo sapiens]
  • Gene Name URL:

    SCP2
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/BC005911