MAPK12 Antibody

CAT:
247-OAAL00298-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAPK12 Antibody - image 1

MAPK12 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Mitogen-activated protein kinase 12
  • Gene Aliases :

    ERK3; ERK6; ERK-6; extracellular signal-regulated kinase 6; MAP kinase 12; MAP kinase p38 gamma; MAPK 12; mitogen-activated protein kinase 12; mitogen-activated protein kinase 3; mitogen-activated protein kinase p38 gamma; P38GAMMA; PRKM12; SAPK3; SAPK-3; stress-activated protein kinase 3.
  • Gene ID :

    6300
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH15741.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    MAPK12 (AAH15741.1, 1 a.a. ~ 367 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    4F4-3D2
  • Type :

    Monoclonal Antibody
  • Sequence :

    MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 kappa
  • NCBI Gene Symbol :

    MAPK12
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens mitogen-activated protein kinase 12, mRNA (cDNA clone MGC:23021 IMAGE:4907996), complete cds|Mitogen-activated protein kinase 12 [Homo sapiens]
  • Gene Name URL :

    MAPK12
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC015741

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide