MAPK12 Antibody

• Gene Name:

  Mitogen-activated protein kinase 12

• Gene Aliases:

  ERK3; ERK6; ERK-6; extracellular signal-regulated kinase 6; MAP kinase 12; MAP kinase p38 gamma; MAPK 12; mitogen-activated protein kinase 12; mitogen-activated protein kinase 3; mitogen-activated protein kinase p38 gamma; P38GAMMA; PRKM12; SAPK3; SAPK-3; stress-activated protein kinase 3.

• Gene ID:

  6300

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH15741.1

• Reactivity:

  Human, Mouse

• Immunogen:

  MAPK12 (AAH15741.1, 1 a.a. ~ 367 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  4F4-3D2

• Type:

  Monoclonal Antibody

• Sequence:

  MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 kappa

• NCBI Gene Symbol:

  MAPK12

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens mitogen-activated protein kinase 12, mRNA (cDNA clone MGC:23021 IMAGE:4907996), complete cds|Mitogen-activated protein kinase 12 [Homo sapiens]

• Gene Name URL:

  MAPK12

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC015741