RPL32 Antibody

CAT:
247-OAAL00292-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RPL32 Antibody - image 1

RPL32 Antibody

  • Gene Name :

    Ribosomal protein L32
  • Gene Aliases :

    60S ribosomal protein L32; L32; large ribosomal subunit protein eL32; PP9932.
  • Gene ID :

    6161
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_000985
  • Reactivity :

    Human, Mouse
  • Immunogen :

    RPL32 (NP_000985, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene.
  • Clonality :

    Monoclonal
  • Clone :

    1B11
  • Type :

    Monoclonal Antibody
  • Sequence :

    RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    0.5 mg/ml
  • Format :

    Liquid// 1X PBS (pH 7.4)
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    RPL32
  • Host or Source :

    Mouse
  • Protein Name :

    60S ribosomal protein L32 [Homo sapiens]|Homo sapiens ribosomal protein L32 (RPL32), transcript variant 1, mRNA
  • Gene Name URL :

    RPL32
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_000994

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide