RPL17 Antibody

CAT:
247-OAAL00290-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RPL17 Antibody - image 1

RPL17 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Ribosomal protein L17
  • Gene Aliases :

    60S ribosomal protein L17;60S ribosomal protein L23; gene encoding putative NFkB activating protein; L17; large ribosomal subunit protein uL22; PD-1; RPL23.
  • Gene ID :

    6139
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH00502
  • Reactivity :

    Human, Mouse
  • Immunogen :

    RPL17 (AAH00502, 1 a.a. ~ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L22P family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as rpL23 because the encoded protein shares amino acid identity with ribosomal protein L23 from Halobacterium marismortui; however, its official symbol is RPL17. Two alternative splice variants have been observed, each encoding the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3G11
  • Type :

    Monoclonal Antibody
  • Sequence :

    MVRYSLDPEDPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKVRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQKLMARE
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    RPL17
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens ribosomal protein L17, mRNA (cDNA clone MGC:8457 IMAGE:2821464), complete cds|Ribosomal protein L17 [Homo sapiens]
  • Gene Name URL :

    RPL17
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC000502

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide