RORB Antibody

CAT:
247-OAAL00288-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RORB Antibody - image 1

RORB Antibody

  • Gene Name :

    RAR related orphan receptor B
  • Gene Aliases :

    BA133M9.1; EIG15; NR1F2; nuclear receptor ROR-beta; nuclear receptor RZR-beta; nuclear receptor subfamily 1 group F member 2; RAR-related orphan receptor beta; retinoic acid-binding receptor beta; retinoid-related orphan receptor beta; ROR-BETA; RZRB; RZR-BETA.
  • Gene ID :

    6096
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_008845
  • Reactivity :

    Human, Mouse
  • Immunogen :

    RORB (NP_008845, 136 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    4B4
  • Type :

    Monoclonal Antibody
  • Sequence :

    ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHL
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    RORB
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens RAR related orphan receptor B (RORB), mRNA|nuclear receptor ROR-beta [Homo sapiens]
  • Gene Name URL :

    RORB
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_006914