RNF2 Antibody

CAT:
247-OAAL00286-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RNF2 Antibody - image 1

RNF2 Antibody

  • Gene Name :

    Ring finger protein 2
  • Gene Aliases :

    BAP1; BAP-1; DING; E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; HIPI3; huntingtin-interacting protein 2-interacting protein 3; LUSYAM; protein DinG; RING finger protein 1B; RING finger protein BAP-1; RING1B; RING2; RING-type E3 ubiquitin transferase RING2.
  • Gene ID :

    6045
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_009143
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2) . Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3B8
  • Type :

    Monoclonal Antibody
  • Sequence :

    PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    RNF2
  • Host or Source :

    Mouse
  • Protein Name :

    E3 ubiquitin-protein ligase RING2 [Homo sapiens]|Homo sapiens ring finger protein 2 (RNF2), mRNA
  • Gene Name URL :

    RNF2
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_007212

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide