RABIF Antibody

• Gene Name:

  RAB interacting factor

• Gene Aliases:

  Guanine nucleotide exchange factor MSS4; mammalian suppressor of SEC4; MSS4; rab-interacting factor; RASGFR3; RASGRF3; Ras-specific guanine-releasing factor 3.

• Gene ID:

  5877

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH18488

• Reactivity:

  Human, Mouse

• Immunogen:

  RABIF (AAH18488, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The Sec4/Rab-related small GTP-binding proteins are involved in the regulation of intracellular vesicular transport. Mss4 stimulates GTP-GDP exchange in Sec4 and Rab and binds to a subset of genetically related Rab proteins.[supplied by OMIM

• Clonality:

  Monoclonal

• Clone:

  2G3

• Type:

  Monoclonal Antibody

• Sequence:

  MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE

• Applications:

  Enzyme-linked immunosorbent assay

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  RABIF

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens RAB interacting factor, mRNA (cDNA clone MGC:21266 IMAGE:4475846), complete cds|RAB interacting factor [Homo sapiens]

• Gene Name URL:

  RABIF

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC018488