DNAJC3 Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  DnaJ heat shock protein family (Hsp40) member C3

• Gene Aliases :

  ACPHD; DnaJ (Hsp40) homolog, subfamily C, member 3; dnaJ homolog subfamily C member 3; endoplasmic reticulum DNA J domain-containing protein 6; ERdj6; ER-resident protein ERdj6; HP58; interferon-induced, double-stranded RNA-activated protein kinase inhibitor; P58; p58 (IPK) ; P58IPK; PRKRI; protein kinase inhibitor of 58 kDa; protein kinase inhibitor p58; protein-kinase, interferon-inducible double stranded RNA dependent inhibitor.

• Gene ID :

  5611

• Accession Number :

  AAH33823

• Reactivity :

  Human, Mouse

• Immunogen :

  DNAJC3 (AAH33823, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  The protein encoded by this gene contains multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR) . [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  S2

• Type :

  Monoclonal Antibody

• Sequence :

  MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  DNAJC3

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens DnaJ (Hsp40) homolog, subfamily C, member 3, mRNA (cDNA clone IMAGE:5218144), with apparent retained intron

• Gene Name URL :

  DNAJC3

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC033823