MAPK11 Antibody

CAT:
247-OAAL00260-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAPK11 Antibody - image 1

MAPK11 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Mitogen-activated protein kinase 11
  • Gene Aliases :

    MAP kinase 11; MAP kinase p38 beta; mitogen-activated protein kinase 11; mitogen-activated protein kinase p38 beta; mitogen-activated protein kinase p38-2; p38-2; P38B; p38Beta; P38BETA2; PRKM11; SAPK2; SAPK2B; stress-activated protein kinase-2; stress-activated protein kinase-2b.
  • Gene ID :

    5600
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH27933
  • Reactivity :

    Human, Mouse
  • Immunogen :

    MAPK11 (AAH27933, 255 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    1F9
  • Type :

    Monoclonal Antibody
  • Sequence :

    ARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    MAPK11
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens mitogen-activated protein kinase 11, mRNA (cDNA clone MGC:34566 IMAGE:5199628), complete cds|Mitogen-activated protein kinase 11 [Homo sapiens]
  • Gene Name URL :

    MAPK11
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC027933

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide