MAPK6 Antibody

CAT:
247-OAAL00259-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MAPK6 Antibody - image 1

MAPK6 Antibody

  • Gene Name:

    Mitogen-activated protein kinase 6
  • Gene Aliases:

    ERK3; ERK-3; extracellular signal-regulated kinase 3; extracellular signal-regulated kinase, p97; HsT17250; MAP kinase 6; MAPK 6; mitogen-activated protein kinase 6; p97MAPK; p97-MAPK; PRKM6; protein kinase, mitogen-activated 5; protein kinase, mitogen-activated 6.
  • Gene ID:

    5597
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/AAH35492
  • Reactivity:

    Human, Mouse
  • Immunogen:

    MAPK6 (AAH35492, 612 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    The protein encoded by this gene is a member of the Ser/Thr protein kinase family, and is most closely related to mitogen-activated protein kinases (MAP kinases) . MAP kinases also known as extracellular signal-regulated kinases (ERKs), are activated through protein phosphorylation cascades and act as integration points for multiple biochemical signals. This kinase is localized in the nucleus, and has been reported to be activated in fibroblasts upon treatment with serum or phorbol esters. [provided by RefSeq
  • Clonality:

    Monoclonal
  • Clone:

    1G6
  • Type:

    Monoclonal Antibody
  • Sequence:

    EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN
  • Applications:

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2a Kappa
  • NCBI Gene Symbol:

    MAPK6
  • Host or Source:

    Mouse
  • Protein Name:

    Homo sapiens mitogen-activated protein kinase 6, mRNA (cDNA clone MGC:5156 IMAGE:2984834), complete cds|Mitogen-activated protein kinase 6 [Homo sapiens]
  • Gene Name URL:

    MAPK6
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/BC035492