PPOX Antibody

CAT:
247-OAAL00253-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PPOX Antibody - image 1

PPOX Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Protoporphyrinogen oxidase
  • Gene Aliases :

    PPO; protoporphyrinogen oxidase; V290M; VP.
  • Gene ID :

    5498
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH02357
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    2B5
  • Type :

    Monoclonal Antibody
  • Sequence :

    EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    PPOX
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens protoporphyrinogen oxidase, mRNA (cDNA clone MGC:8485 IMAGE:2821983), complete cds|Protoporphyrinogen oxidase [Homo sapiens]
  • Gene Name URL :

    PPOX
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC002357

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide