PLAUR Antibody

• Gene Name:

  Plasminogen activator, urokinase receptor

• Gene Aliases:

  CD87; monocyte activation antigen Mo3; UPAR; U-PAR; u-plasminogen activator receptor form 2; URKR; urokinase plasminogen activator surface receptor; urokinase-type plasminogen activator (uPA) receptor.

• Gene ID:

  5329

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH02788

• Reactivity:

  Human, Mouse

• Immunogen:

  PLAUR (AAH02788, 1 a.a. ~ 335 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1D6

• Type:

  Monoclonal Antibody

• Sequence:

  MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  PLAUR

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens plasminogen activator, urokinase receptor, mRNA (cDNA clone MGC:3905 IMAGE:3617894), complete cds|Plasminogen activator, urokinase receptor [Homo sapiens]

• Gene Name URL:

  PLAUR

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC002788