PI3 Antibody

• Gene Name :

  Peptidase inhibitor 3

• Gene Aliases :

  Cementoin; elafin; elastase-specific inhibitor; ESI; peptidase inhibitor 3, skin-derived; PI-3; pre-elafin; protease inhibitor 3, skin-derived (SKALP) ; protease inhibitor WAP3; SKALP; skin-derived antileukoproteinase; trappin-2; WAP four-disulfide core domain 14; WAP four-disulfide core domain protein 14; WAP3; WFDC14.

• Gene ID :

  5266

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH10952

• Reactivity :

  Human, Mouse

• Immunogen :

  PI3 (AAH10952, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  3G9

• Type :

  Monoclonal Antibody

• Sequence :

  MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 kappa

• NCBI Gene Symbol :

  PI3

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens peptidase inhibitor 3, skin-derived, mRNA (cDNA clone MGC:13613 IMAGE:4083155), complete cds|Peptidase inhibitor 3, skin-derived [Homo sapiens]

• Gene Name URL :

  PI3

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC010952