OCLN Antibody

• Gene Name:

  Occludin

• Gene Aliases:

  BLCPMG; tight junction protein occludin TM4 minus.

• Gene ID:

  4950

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_002529

• Reactivity:

  Human, Mouse

• Immunogen:

  OCLN (NP_002529, 423 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

• Clonality:

  Monoclonal

• Clone:

  5A7

• Type:

  Monoclonal Antibody

• Sequence:

  ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  1 mg/ml

• Format:

  Liquid// PBS (pH 7.4)

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  OCLN

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens occludin (OCLN), transcript variant 1, mRNA|occludin isoform a [Homo sapiens]

• Gene Name URL:

  OCLN

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_002538