MTCP1 Antibody

CAT:
247-OAAL00203-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MTCP1 Antibody - image 1

MTCP1 Antibody

  • Gene Name :

    Mature T cell proliferation 1
  • Gene Aliases :

    Mature T-cell proliferation-1 type B1; MTCP-1 type B1; P13MTCP1; p8MTCP1; protein p13 MTCP-1; TCL1 family AKT coactivator C; TCL1C.
  • Gene ID :

    4515
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH02600
  • Reactivity :

    Human, Mouse
  • Immunogen :

    MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene was identified by involvement in some t (X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    1G12
  • Type :

    Monoclonal Antibody
  • Sequence :

    MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2b Kappa
  • NCBI Gene Symbol :

    MTCP1
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens mature T-cell proliferation 1, mRNA (cDNA clone MGC:2069 IMAGE:3161408), complete cds|Mature T-cell proliferation 1 [Homo sapiens]
  • Gene Name URL :

    MTCP1
  • CAS Number :

    9007-83-4
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC002600

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide