MTCP1 Antibody

• Gene Name:

  Mature T cell proliferation 1

• Gene Aliases:

  Mature T-cell proliferation-1 type B1; MTCP-1 type B1; P13MTCP1; p8MTCP1; protein p13 MTCP-1; TCL1 family AKT coactivator C; TCL1C.

• Gene ID:

  4515

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH02600

• Reactivity:

  Human, Mouse

• Immunogen:

  MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene was identified by involvement in some t (X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1G12

• Type:

  Monoclonal Antibody

• Sequence:

  MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2b Kappa

• NCBI Gene Symbol:

  MTCP1

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens mature T-cell proliferation 1, mRNA (cDNA clone MGC:2069 IMAGE:3161408), complete cds|Mature T-cell proliferation 1 [Homo sapiens]

• Gene Name URL:

  MTCP1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC002600