LAMC1 Antibody

• Gene Name:

  Laminin subunit gamma 1

• Gene Aliases:

  LAMB2; laminin B2 chain; laminin subunit gamma-1; laminin, gamma 1 (formerly LAMB2) ; laminin-10 subunit gamma; laminin-11 subunit gamma; laminin-2 subunit gamma; laminin-3 subunit gamma; laminin-4 subunit gamma; laminin-6 subunit gamma; laminin-7 subunit gamma; laminin-8 subunit gamma; laminin-9 subunit gamma; S-LAM gamma; S-laminin subunit gamma.

• Gene ID:

  3915

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH15586

• Reactivity:

  Human, Mouse

• Immunogen:

  LAMC1 (AAH15586, 1 a.a. ~ 38 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3' UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  M1

• Type:

  Monoclonal Antibody

• Sequence:

  MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS

• Applications:

  Enzyme-linked immunosorbent assay|Proximity ligation assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  LAMC1

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens laminin, gamma 1 (formerly LAMB2), mRNA (cDNA clone IMAGE:4642245), complete cds|LAMC1 protein [Homo sapiens]

• Gene Name URL:

  LAMC1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC015586