FOXK2 Antibody

CAT:
247-OAAL00164-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
FOXK2 Antibody - image 1

FOXK2 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Forkhead box K2
  • Gene Aliases :

    Cellular transcription factor ILF-1; forkhead box protein K2; FOXK1; G/T-mismatch specific binding protein; ILF; ILF1; ILF-1; interleukin enhancer-binding factor 1; nGTBP.
  • Gene ID :

    3607
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_004505.2
  • Reactivity :

    Human, Mouse
  • Immunogen :

    FOXK2 (NP_004505.2, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    4A11
  • Type :

    Monoclonal Antibody
  • Sequence :

    QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    0.5 mg/ml
  • Format :

    Liquid//1X PBS (pH 7.4)
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    FOXK2
  • Host or Source :

    Mouse
  • Protein Name :

    Forkhead box protein K2 [Homo sapiens]|Homo sapiens forkhead box K2 (FOXK2), mRNA
  • Gene Name URL :

    FOXK2
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_004514

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide