ICT1 Antibody

• Gene Name:

  Mitochondrial ribosomal protein L58

• Gene Aliases:

  39S ribosomal protein L58, mitochondrial; digestion substraction 1; DS1; DS-1; ICT1; immature colon carcinoma transcript 1 protein; mitochondrial large ribosomal subunit protein ICT1; mitochondrial large ribosomal subunit protein mL62; MRP-L58; peptidyl-tRNA hydrolase ICT1, mitochondrial.

• Gene ID:

  3396

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_001536

• Reactivity:

  Human, Mouse

• Immunogen:

  ICT1 (NP_001536, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  6F8

• Type:

  Monoclonal Antibody

• Sequence:

  TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  MRPL58

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens mitochondrial ribosomal protein L58 (MRPL58), transcript variant 1, mRNA|peptidyl-tRNA hydrolase ICT1, mitochondrial isoform 1 precursor [Homo sapiens]

• Gene Name URL:

  MRPL58

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_001545