FOXC2 Antibody

• Gene Name:

  Forkhead box C2

• Gene Aliases:

  FKHL14; forkhead box C2 (MFH-1, mesenchyme forkhead 1) ; forkhead box protein C2; forkhead, Drosophila, homolog-like 14; forkhead-related protein FKHL14; LD; mesenchyme fork head protein 1; mesenchyme forkhead 1; MFH1; MFH-1; MFH-1, mesenchyme forkhead 1; transcription factor FKH-14.

• Gene ID:

  2303

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_005242

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  FOXC2 (NP_005242, 156 a.a. ~ 256 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  3H5

• Type:

  Monoclonal Antibody

• Sequence:

  FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2b Kappa

• NCBI Gene Symbol:

  FOXC2

• Host or Source:

  Mouse

• Protein Name:

  Forkhead box protein C2 [Homo sapiens]|Homo sapiens forkhead box C2 (FOXC2), mRNA

• Gene Name URL:

  FOXC2

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_005251