FGF8 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


FGF8 Antibody
Gene Name:
Fibroblast growth factor 8Gene Aliases:
AIGF; androgen-induced growth factor; FGF-8; fibroblast growth factor 8; fibroblast growth factor 8 (androgen-induced) ; HBGF-8; heparin-binding growth factor 8; HH6; KAL6.Gene ID:
2253Accession Number:
https://www.ncbi.nlm.nih.gov/protein/NP_149354Reactivity:
Human, MouseImmunogen:
FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.Target:
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeqClonality:
MonoclonalClone:
3H2Type:
Monoclonal AntibodySequence:
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGKApplications:
Enzyme-linked immunosorbent assay|Western blotAssay Protocol:
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat:
LiquidReconstitution:
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.Fragment:
IgG2a KappaNCBI Gene Symbol:
FGF8Host or Source:
MouseProtein Name:
Fibroblast growth factor 8 isoform E precursor [Homo sapiens]|Homo sapiens fibroblast growth factor 8 (FGF8), transcript variant E, mRNAGene Name URL:
FGF8CAS Number:
9007-83-4Nucleotide Accession Number:
https://www.ncbi.nlm.nih.gov/nuccore/NM_033164
