MARK2 Antibody

• Gene Name :

  Microtubule affinity regulating kinase 2

• Gene Aliases :

  ELKL motif kinase 1; EMK1; EMK-1; MAP/microtubule affinity-regulating kinase 2; PAR-1; PAR1 homolog b; Par1b; Par-1b; Ser/Thr protein kinase PAR-1B; serine/threonine protein kinase EMK; serine/threonine-protein kinase MARK2; testicular tissue protein Li 117.

• Gene ID :

  2011

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH08771

• Reactivity :

  Human, Mouse

• Immunogen :

  MARK2 (AAH08771, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a member of the Par-1 family of serine/threonine protein kinases. The protein is an important regulator of cell polarity in epithelial and neuronal cells, and also controls the stability of microtubules through phosphorylation and inactivation of several microtubule-associating proteins. The protein localizes to cell membranes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  3C5

• Type :

  Monoclonal Antibody

• Sequence :

  QAAGPAIPTSNSYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPG

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  MARK2

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens MAP/microtubule affinity-regulating kinase 2, mRNA (cDNA clone IMAGE:3139103), partial cds|MARK2 protein, partial [Homo sapiens]

• Gene Name URL :

  MARK2

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC008771