ELF3 Antibody

• Gene Name:

  E74 like ETS transcription factor 3

• Gene Aliases:

  E74-like factor 3 (ets domain transcription factor) ; E74-like factor 3 (ets domain transcription factor, epithelial-specific) ; E74-like factor 3 (ETS domain transcription factor, serine box, epithelial-specific) ; epithelial-restricted with serine box; epithelium-restricted Ets protein ESX; epithelium-specific Ets transcription factor 1; EPR-1; ERT; ESE-1; ESX; ets domain transcription factor, serine box (epithelial-specific) ; ETS-related transcription factor Elf-3.

• Gene ID:

  1999

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH03569

• Reactivity:

  Human, Mouse

• Immunogen:

  ELF3 (AAH03569, 262 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Clonality:

  Monoclonal

• Clone:

  1D8

• Type:

  Monoclonal Antibody

• Sequence:

  EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 Kappa

• NCBI Gene Symbol:

  ELF3

• Host or Source:

  Mouse

• Protein Name:

  ELF3 protein [Homo sapiens]|Homo sapiens E74-like factor 3 (ets domain transcription factor, epithelial-specific), mRNA (cDNA clone MGC:2088 IMAGE:3537846), complete cds

• Gene Name URL:

  ELF3

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC003569