EIF2D Antibody

• Gene Name :

  Eukaryotic translation initiation factor 2D

• Gene Aliases :

  Eukaryotic translation initiation factor 2D; HCA56; hepatocellular carcinoma-associated antigen 56; LGTN; ligatin.

• Gene ID :

  1939

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_008824.2

• Reactivity :

  Human, Mouse

• Immunogen :

  EIF2D (NP_008824.2, 485 a.a. ~ 584 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  2D10

• Type :

  Monoclonal Antibody

• Sequence :

  KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  EIF2D

• Host or Source :

  Mouse

• Protein Name :

  Eukaryotic translation initiation factor 2D isoform 1 [Homo sapiens]|Homo sapiens eukaryotic translation initiation factor 2D (EIF2D), transcript variant 1, mRNA

• Gene Name URL :

  EIF2D

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_006893