PHC1 Antibody

CAT:
247-OAAL00084-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PHC1 Antibody - image 1

PHC1 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Polyhomeotic homolog 1
  • Gene Aliases :

    Early development regulator 1 (homolog of polyhomeotic 1) ; early development regulatory protein 1; EDR1; HPH1; MCPH11; polyhomeotic-like 1; polyhomeotic-like protein 1; RAE28.
  • Gene ID :

    1911
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_004417
  • Reactivity :

    Human, Mouse
  • Immunogen :

    PHC1 (NP_004417, 751 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    3G1
  • Type :

    Monoclonal Antibody
  • Sequence :

    PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY*
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2b Kappa
  • NCBI Gene Symbol :

    PHC1
  • Host or Source :

    Mouse
  • Protein Name :

    Homo sapiens polyhomeotic homolog 1 (PHC1), mRNA|polyhomeotic-like protein 1 [Homo sapiens]
  • Gene Name URL :

    PHC1
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_004426

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide