PHC1 Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  Polyhomeotic homolog 1

• Gene Aliases :

  Early development regulator 1 (homolog of polyhomeotic 1) ; early development regulatory protein 1; EDR1; HPH1; MCPH11; polyhomeotic-like 1; polyhomeotic-like protein 1; RAE28.

• Gene ID :

  1911

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_004417

• Reactivity :

  Human, Mouse

• Immunogen :

  PHC1 (NP_004417, 751 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  3G1

• Type :

  Monoclonal Antibody

• Sequence :

  PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY*

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2b Kappa

• NCBI Gene Symbol :

  PHC1

• Host or Source :

  Mouse

• Protein Name :

  Homo sapiens polyhomeotic homolog 1 (PHC1), mRNA|polyhomeotic-like protein 1 [Homo sapiens]

• Gene Name URL :

  PHC1

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_004426