DFFA Antibody

CAT:
247-OAAL00071-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
DFFA Antibody - image 1

DFFA Antibody

  • Gene Name:

    DNA fragmentation factor subunit alpha
  • Gene Aliases:

    DFF1; DFF45; DFF-45; DNA fragmentation factor 45 kDa subunit; DNA fragmentation factor subunit alpha; DNA fragmentation factor, 45kDa, alpha polypeptide; ICAD; inhibitor of CAD.
  • Gene ID:

    1676
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/NP_004392.1
  • Reactivity:

    Human, Mouse
  • Immunogen:

    DFFA (NP_004392.1, 231 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Clonality:

    Monoclonal
  • Clone:

    3A11
  • Type:

    Monoclonal Antibody
  • Sequence:

    TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
  • Applications:

    Enzyme-linked immunosorbent assay|Proximity ligation assay|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2a Kappa
  • NCBI Gene Symbol:

    DFFA
  • Host or Source:

    Mouse
  • Protein Name:

    DNA fragmentation factor subunit alpha isoform 1 [Homo sapiens]|Homo sapiens DNA fragmentation factor subunit alpha (DFFA), transcript variant 1, mRNA
  • Gene Name URL:

    DFFA
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/NM_004401