NKX2-5 Antibody

CAT:
247-OAAL00063-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
NKX2-5 Antibody - image 1

NKX2-5 Antibody

  • Gene Name:

    NK2 homeobox 5
  • Gene Aliases:

    Cardiac-specific homeobox 1; CHNG5; CSX; CSX1; HLHS2; homeobox protein CSX; homeobox protein NK-2 homolog E; homeobox protein NKX 2-5; homeobox protein Nkx-2.5; NK2 transcription factor related, locus 5; NKX 2-5; NKX2.5; NKX2E; NKX4-1; tinman homolog; tinman paralog; VSD3.
  • Gene ID:

    1482
  • Accession Number:

    https://www.ncbi.nlm.nih.gov/protein/NP_004378
  • Reactivity:

    Human, Mouse
  • Immunogen:

    NKX2-5 (NP_004378, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target:

    Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]) . It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM
  • Clonality:

    Monoclonal
  • Clone:

    3A7
  • Type:

    Monoclonal Antibody
  • Sequence:

    MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA*
  • Applications:

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol:

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format:

    Liquid
  • Reconstitution:

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment:

    IgG2b Kappa
  • NCBI Gene Symbol:

    NKX2-5
  • Host or Source:

    Mouse
  • Protein Name:

    Homeobox protein Nkx-2.5 isoform 1 [Homo sapiens]|Homo sapiens NK2 homeobox 5 (NKX2-5), transcript variant 1, mRNA
  • Gene Name URL:

    NKX2-5
  • CAS Number:

    9007-83-4
  • Nucleotide Accession Number:

    https://www.ncbi.nlm.nih.gov/nuccore/NM_004387