CPT2 Antibody

• Gene Name:

  Carnitine palmitoyltransferase 2

• Gene Aliases:

  Carnitine O-palmitoyltransferase 2, mitochondrial; carnitine palmitoyltransferase II; CPT II; CPT1; CPTASE; IIAE4; testicular secretory protein Li 13.

• Gene ID:

  1376

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH05172

• Reactivity:

  Human, Mouse

• Immunogen:

  CPT2 (AAH05172, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  10000000000

• Type:

  Monoclonal Antibody

• Sequence:

  WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR

• Applications:

  Enzyme-linked immunosorbent assay

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  CPT2

• Host or Source:

  Mouse

• Protein Name:

  Carnitine palmitoyltransferase 2 [Homo sapiens]|Homo sapiens carnitine palmitoyltransferase 2, mRNA (cDNA clone MGC:4851 IMAGE:3605012), complete cds

• Gene Name URL:

  CPT2

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC005172