COX6C Antibody

CAT:
247-OAAL00054-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
COX6C Antibody - image 1

COX6C Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Cytochrome c oxidase subunit 6C
  • Gene Aliases :

    Cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit 6C; cytochrome c oxidase subunit VIc preprotein; epididymis secretory sperm binding protein.
  • Gene ID :

    1345
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/AAH00187
  • Reactivity :

    Human, Mouse
  • Immunogen :

    COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    S51
  • Type :

    Monoclonal Antibody
  • Sequence :

    MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
  • Applications :

    Enzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    COX6C
  • Host or Source :

    Mouse
  • Protein Name :

    Cytochrome c oxidase subunit VIc [Homo sapiens]|Homo sapiens cytochrome c oxidase subunit VIc, mRNA (cDNA clone MGC:1520 IMAGE:3350637), complete cds
  • Gene Name URL :

    COX6C
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/BC000187

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide