ABCC2 Antibody

CAT:
247-OAAL00048-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ABCC2 Antibody - image 1

ABCC2 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    ATP binding cassette subfamily C member 2
  • Gene Aliases :

    ABC30; ATP-binding cassette sub-family C member 2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; canalicular multidrug resistance protein; canalicular multispecific organic anion transporter 1; CMOAT; cMRP; DJS; MRP2; multidrug resistance-associated protein 2.
  • Gene ID :

    1244
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_000383
  • Reactivity :

    Human, Mouse
  • Immunogen :

    ABCC2 (NP_000383, 214 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq]
  • Clonality :

    Monoclonal
  • Clone :

    2H6
  • Type :

    Monoclonal Antibody
  • Sequence :

    LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
  • Applications :

    Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Concentration :

    0.5 mg/ml
  • Format :

    Liquid.// PBS, pH 7.4
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG1 Kappa
  • NCBI Gene Symbol :

    ABCC2
  • Host or Source :

    Mouse
  • Protein Name :

    Canalicular multispecific organic anion transporter 1 [Homo sapiens]|Homo sapiens ATP binding cassette subfamily C member 2 (ABCC2), mRNA
  • Gene Name URL :

    ABCC2
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_000392

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide