ABCC2 Antibody

• Gene Name :

  ATP binding cassette subfamily C member 2

• Gene Aliases :

  ABC30; ATP-binding cassette sub-family C member 2; ATP-binding cassette, sub-family C (CFTR/MRP), member 2; canalicular multidrug resistance protein; canalicular multispecific organic anion transporter 1; CMOAT; cMRP; DJS; MRP2; multidrug resistance-associated protein 2.

• Gene ID :

  1244

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_000383

• Reactivity :

  Human, Mouse

• Immunogen :

  ABCC2 (NP_000383, 214 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq]

• Clonality :

  Monoclonal

• Clone :

  2H6

• Type :

  Monoclonal Antibody

• Sequence :

  LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  0.5 mg/ml

• Format :

  Liquid.// PBS, pH 7.4

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 Kappa

• NCBI Gene Symbol :

  ABCC2

• Host or Source :

  Mouse

• Protein Name :

  Canalicular multispecific organic anion transporter 1 [Homo sapiens]|Homo sapiens ATP binding cassette subfamily C member 2 (ABCC2), mRNA

• Gene Name URL :

  ABCC2

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_000392