CLTA Antibody

CAT:
247-OAAL00047-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CLTA Antibody - image 1

CLTA Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    Clathrin light chain A
  • Gene Aliases :

    Clathrin light chain A; clathrin, light polypeptide (Lca) ; LCA.
  • Gene ID :

    1211
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_001824.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    CLTA (NP_001824.1, 118 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    4000000000
  • Type :

    Monoclonal Antibody
  • Sequence :

    MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    CLTA
  • Host or Source :

    Mouse
  • Protein Name :

    Clathrin light chain A isoform a [Homo sapiens]|Homo sapiens clathrin light chain A (CLTA), transcript variant 1, mRNA
  • Gene Name URL :

    CLTA
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_001833

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide