CEBPG Antibody

• Gene Name :

  CCAAT enhancer binding protein gamma

• Gene Aliases :

  C/EBP gamma; CCAAT/enhancer binding protein (C/EBP), gamma; CCAAT/enhancer-binding protein gamma; GPE1BP; IG/EBP-1.

• Gene ID :

  1054

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/AAH13128

• Reactivity :

  Human, Mouse

• Immunogen :

  CEBPG (AAH13128, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  The C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein: a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. The C/EBP family consist of several related proteins, C/EBP alpha, C/EBP beta, C/EBP gamma, and C/EBP delta, that form homodimers and that form heterodimers with each other. CCAAT/enhancer binding protein gamma may cooperate with Fos to bind PRE-I enhancer elements. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  S2

• Type :

  Monoclonal Antibody

• Sequence :

  MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

• Applications :

  Enzyme-linked immunosorbent assay|Immunoprecipitation|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 Kappa

• NCBI Gene Symbol :

  CEBPG

• Host or Source :

  Mouse

• Protein Name :

  CCAAT/enhancer binding protein (C/EBP), gamma [Homo sapiens]|Homo sapiens CCAAT/enhancer binding protein (C/EBP), gamma, mRNA (cDNA clone MGC:5089 IMAGE:3445301), complete cds

• Gene Name URL :

  CEBPG

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/BC013128