CACNA1F Antibody

• Gene Name:

  Calcium voltage-gated channel subunit alpha1 F

• Gene Aliases:

  AIED; calcium channel, voltage-dependent, L type, alpha 1F subunit; Cav1.4; Cav1.4alpha1; COD3; COD4; CORDX; CORDX3; CSNB2; CSNB2A; CSNBX2; JM8; JMC8; OA2; voltage-dependent L-type calcium channel subunit alpha-1F; voltage-gated calcium channel subunit alpha Cav1.4.

• Gene ID:

  778

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_005174

• Reactivity:

  Human, Mouse

• Immunogen:

  CACNA1F (NP_005174, 1878 a.a. ~ 1977 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  This gene encodes a member of the alpha-1 subunit family; a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants of the gene described here have been observed but have not been thoroughly characterized. Mutations in this gene have been shown to cause incomplete X-linked congential stationary night blindness type 2 (CSNB2) . [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1H6

• Type:

  Monoclonal Antibody

• Sequence:

  LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG3 Kappa

• NCBI Gene Symbol:

  CACNA1F

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens calcium voltage-gated channel subunit alpha1 F (CACNA1F), transcript variant 1, mRNA|voltage-dependent L-type calcium channel subunit alpha-1F isoform 1 [Homo sapiens]

• Gene Name URL:

  CACNA1F

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_005183