TSPO Antibody

• Gene Name:

  Translocator protein

• Gene Aliases:

  Benzodiazepine peripheral binding site; BPBS; BZRP; DBI; IBP; MBR; mDRC; mitochondrial benzodiazepine receptor; PBR; PBS; peripheral-type benzodiazepine receptor; pk18; PKBS; PTBR; translocator protein.

• Gene ID:

  706

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/AAH01110.1

• Reactivity:

  Human, Mouse

• Immunogen:

  BZRP (AAH01110.1, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  3D8-B2

• Type:

  Monoclonal Antibody

• Sequence:

  MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE

• Applications:

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid//1X PBS (pH 7.4)

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG1 kappa

• NCBI Gene Symbol:

  TSPO

• Host or Source:

  Mouse

• Protein Name:

  Homo sapiens translocator protein (18kDa), mRNA (cDNA clone MGC:1184 IMAGE:2989070), complete cds|Translocator protein (18kDa) [Homo sapiens]

• Gene Name URL:

  TSPO

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/BC001110