BCL2L2 Antibody

• CAS Number :

  9007-83-4

• Gene Name :

  BCL2 like 2

• Gene Aliases :

  Apoptosis regulator BCL-W; BCL2-L-2; bcl-2-like protein 2; BCLW; BCL-W; PPP1R51; protein phosphatase 1, regulatory subunit 51.

• Gene ID :

  599

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_004041.1

• Reactivity :

  Human, Mouse

• Immunogen :

  BCL2L2 (NP_004041.1, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  20000

• Type :

  Monoclonal Antibody

• Sequence :

  MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  BCL2L2

• Host or Source :

  Mouse

• Protein Name :

  Bcl-2-like protein 2 [Homo sapiens]|Homo sapiens BCL2 like 2 (BCL2L2), transcript variant 1, mRNA

• Gene Name URL :

  BCL2L2

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_004050.2