BCL2L2 Antibody

CAT:
247-OAAL00025-100UG
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BCL2L2 Antibody - image 1

BCL2L2 Antibody

  • CAS Number :

    9007-83-4
  • Gene Name :

    BCL2 like 2
  • Gene Aliases :

    Apoptosis regulator BCL-W; BCL2-L-2; bcl-2-like protein 2; BCLW; BCL-W; PPP1R51; protein phosphatase 1, regulatory subunit 51.
  • Gene ID :

    599
  • Accession Number :

    https://www.ncbi.nlm.nih.gov/protein/NP_004041.1
  • Reactivity :

    Human, Mouse
  • Immunogen :

    BCL2L2 (NP_004041.1, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Target :

    This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. [provided by RefSeq
  • Clonality :

    Monoclonal
  • Clone :

    20000
  • Type :

    Monoclonal Antibody
  • Sequence :

    MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
  • Applications :

    Enzyme-linked immunosorbent assay|Western blot
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    Liquid
  • Reconstitution :

    Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
  • Fragment :

    IgG2a Kappa
  • NCBI Gene Symbol :

    BCL2L2
  • Host or Source :

    Mouse
  • Protein Name :

    Bcl-2-like protein 2 [Homo sapiens]|Homo sapiens BCL2 like 2 (BCL2L2), transcript variant 1, mRNA
  • Gene Name URL :

    BCL2L2
  • Nucleotide Accession Number :

    https://www.ncbi.nlm.nih.gov/nuccore/NM_004050.2

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide