RERE Antibody

• Gene Name :

  Arginine-glutamic acid dipeptide repeats

• Gene Aliases :

  ARG; arginine-glutamic acid dipeptide (RE) repeats; arginine-glutamic acid dipeptide repeats protein; ARP; ATN1L; atrophin 2; atrophin-1 like protein; atrophin-1 related protein; DNB1; NEDBEH.

• Gene ID :

  473

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_036234.2

• Reactivity :

  Human, Mouse

• Immunogen :

  RERE (NP_036234.2, 85 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  2F2

• Type :

  Monoclonal Antibody

• Sequence :

  RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEV

• Applications :

  Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG2a Kappa

• NCBI Gene Symbol :

  RERE

• Host or Source :

  Mouse

• Protein Name :

  Arginine-glutamic acid dipeptide repeats protein isoform a [Homo sapiens]|Homo sapiens arginine-glutamic acid dipeptide repeats (RERE), transcript variant 1, mRNA

• Gene Name URL :

  RERE

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_012102