ADH4 Antibody

• Gene Name :

  Alcohol dehydrogenase 4 (class II), pi polypeptide

• Gene Aliases :

  ADH-2; alcohol dehydrogenase class II pi chain; aldehyde reductase; all-trans-retinol dehydrogenase [NAD (+) ] ADH4; epididymis secretory protein Li 4; HEL-S-4.

• Gene ID :

  127

• Accession Number :

  https://www.ncbi.nlm.nih.gov/protein/NP_000661

• Reactivity :

  Human, Mouse

• Immunogen :

  ADH4 (NP_000661, 52 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target :

  This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. [provided by RefSeq

• Clonality :

  Monoclonal

• Clone :

  3C5

• Type :

  Monoclonal Antibody

• Sequence :

  SVIDSKFEGLAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTS

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Liquid

• Reconstitution :

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment :

  IgG1 Kappa

• NCBI Gene Symbol :

  ADH4

• Host or Source :

  Mouse

• Protein Name :

  Alcohol dehydrogenase 4 isoform 2 [Homo sapiens]|Homo sapiens alcohol dehydrogenase 4 (class II), pi polypeptide (ADH4), transcript variant 3, mRNA

• Gene Name URL :

  ADH4

• CAS Number :

  9007-83-4

• Nucleotide Accession Number :

  https://www.ncbi.nlm.nih.gov/nuccore/NM_000670