ABCF1 Antibody

• Gene Name:

  ATP binding cassette subfamily F member 1

• Gene Aliases:

  ABC27; ABC50; ATP-binding cassette 50 (TNF-alpha stimulated) ; ATP-binding cassette sub-family F member 1; ATP-binding cassette, sub-family F (GCN20), member 1; TNFalpha-inducible ATP-binding protein; TNF-alpha-stimulated ABC protein.

• Gene ID:

  23

• Accession Number:

  https://www.ncbi.nlm.nih.gov/protein/NP_001081

• Reactivity:

  Human, Mouse

• Immunogen:

  ABCF1 (NP_001081, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

• Target:

  The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq

• Clonality:

  Monoclonal

• Clone:

  1B4

• Type:

  Monoclonal Antibody

• Sequence:

  GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES

• Applications:

  Enzyme-linked immunosorbent assay|Immunofluorescence

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid

• Reconstitution:

  Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.

• Fragment:

  IgG2a Kappa

• NCBI Gene Symbol:

  ABCF1

• Host or Source:

  Mouse

• Protein Name:

  ATP-binding cassette sub-family F member 1 isoform b [Homo sapiens]|Homo sapiens ATP binding cassette subfamily F member 1 (ABCF1), transcript variant 2, mRNA

• Gene Name URL:

  ABCF1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  https://www.ncbi.nlm.nih.gov/nuccore/NM_001090