IL29 Antibody

• Gene Name :

  Interferon lambda 1

• Gene Aliases :

  Cytokine Zcyto21; IFN-lambda-1; IL29; IL-29; interferon lambda-1; interleukin 29 (interferon, lambda 1) ; interleukin-29.

• Gene ID :

  282618

• Swiss Prot :

  Q8IU54

• Reactivity :

  Human|Mouse|Rat

• Immunogen :

  The antiserum was produced against synthesized peptide derived from the Internal region of human IL29.

• Target :

  Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression.

• Clonality :

  Polyclonal

• Type :

  Polyclonal Antibody

• Sequence :

  LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVT

• Applications :

  Enzyme-linked immunosorbent assay|Western blot

• Purification :

  The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration :

  1 mg/ml

• Format :

  Liquid// PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.

• Reconstitution :

  -20°C

• Molecular Weight :

  21 kDa

• Specificity :

  IL29 Antibody detects endogenous levels of IL29 protein.

• NCBI Gene Symbol :

  IFNL1

• Host or Source :

  Rabbit

• Protein Name :

  Interferon lambda-1

• Gene Name URL :

  IFNL1

• CAS Number :

  9007-83-4