LY9 Antibody

9007-83-4

Lymphocyte antigen 9

CD229; cell surface molecule Ly-9; hly9; Lymphocyte antigen 9; mLY9; signaling lymphocytic activation molecule 3; SLAM family member 3; SLAMF3; T-lymphocyte surface antigen Ly-9.

4063

Q9HBG7

Human|Mouse|Rat

The antiserum was produced against synthesized peptide derived from the Internal region of human LY9.

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. May participate in adhesion reactions between T lymphocytes and accessory cells by homophilic interaction. Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A (PubMed:22184727) . Promotes recruitment of RORC to the IL-17 promoter (PubMed:22989874) . May be involved in the maintenance of peripheral cell tolerance by serving as a negative regulator of the immune response. May disable autoantibody responses and inhibit IFN-gamma secretion by CD4 (+) T-cells. May negatively regulate the size of thymic innate CD8 (+) T-cells and the development of invariant natural killer T (iNKT) cells (By similarity) .

Polyclonal Antibody

LGEPVTLPLALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYK

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot

The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

1mg/ml

-20°C

72 kDa

LY9 Antibody detects endogenous levels of LY9 protein.

LY9

Rabbit

T-lymphocyte surface antigen Ly-9